Matsya DanceMatsya Dance
Nature & Wildlife

Matsya Dance

by Karuna Devi

2,800

Natural mineral colors on cotton canvas 30.00 × 40.00 cm 142 views
Not currently available for purchase

Eight sacred fish arranged in an intricate dance formation — a beloved motif in Mithila tradition symbolizing fertility, prosperity and the auspiciousness of water. Executed in the Kachni style with exceptionally fine hatched lines and cross-hatching that gives each fish a unique texture while the overall composition flows as one dynamic circular rhythm. The border carries the traditional double-fish motif that appears on wedding invitations across the Mithila region.

About the Artist

Karuna Devi carries forward the legendary fish-and-aquatic tradition of her mother Ganga Devi (1928–1991), who was one of the first Madhubani artists to gain international recognition. Karuna has preserved the Kachni line style in its purest form and teaches it to young women in Ranti village, Madhubani.

fishmatsyakachnifertilitydanceaquaticprosperity